Lineage for d1j4ad2 (1j4a D:2-103,D:301-333)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465923Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2465924Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2465932Protein D-lactate dehydrogenase [52295] (1 species)
  7. 2465933Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)
  8. 2465937Domain d1j4ad2: 1j4a D:2-103,D:301-333 [71509]
    Other proteins in same PDB: d1j4aa1, d1j4ab1, d1j4ac1, d1j4ad1
    complexed with so4

Details for d1j4ad2

PDB Entry: 1j4a (more details), 1.9 Å

PDB Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus
PDB Compounds: (D:) d-lactate dehydrogenase

SCOPe Domain Sequences for d1j4ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ad2 c.23.12.1 (D:2-103,D:301-333) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvysXytthavrnmvvkafdnn
lelvegkeaetpvkvg

SCOPe Domain Coordinates for d1j4ad2:

Click to download the PDB-style file with coordinates for d1j4ad2.
(The format of our PDB-style files is described here.)

Timeline for d1j4ad2: