Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein D-lactate dehydrogenase [51841] (1 species) |
Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries) |
Domain d1j4ad1: 1j4a D:104-300 [71508] Other proteins in same PDB: d1j4aa2, d1j4ab2, d1j4ac2, d1j4ad2 |
PDB Entry: 1j4a (more details), 1.9 Å
SCOP Domain Sequences for d1j4ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4ad1 c.2.1.4 (D:104-300) D-lactate dehydrogenase {Lactobacillus helveticus} pnaiaehaaiqaarilrqdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmq imegfgakvitydifrnpelekkgyyvdslddlykqadvislhvpdvpanvhmindesia kmkqdvvivnvsrgplvdtdavirgldsgkifgyamdvyegevgifnedwegkefpdarl adliarpnvlvtpktaf
Timeline for d1j4ad1: