Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
Protein D-lactate dehydrogenase [52295] (1 species) |
Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries) |
Domain d1j4ab2: 1j4a B:2-103,B:301-332 [71505] Other proteins in same PDB: d1j4aa1, d1j4ab1, d1j4ac1, d1j4ad1 complexed with so4 |
PDB Entry: 1j4a (more details), 1.9 Å
SCOPe Domain Sequences for d1j4ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4ab2 c.23.12.1 (B:2-103,B:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvysXytthavrnmvvkafdnn lelvegkeaetpvkv
Timeline for d1j4ab2: