Lineage for d1j4ab2 (1j4a B:2-103,B:301-332)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178031Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 178032Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (6 proteins)
  6. 178040Protein D-lactate dehydrogenase [52295] (1 species)
  7. 178041Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)
  8. 178043Domain d1j4ab2: 1j4a B:2-103,B:301-332 [71505]
    Other proteins in same PDB: d1j4aa1, d1j4ab1, d1j4ac1, d1j4ad1

Details for d1j4ab2

PDB Entry: 1j4a (more details), 1.9 Å

PDB Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus

SCOP Domain Sequences for d1j4ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ab2 c.23.12.1 (B:2-103,B:301-332) D-lactate dehydrogenase {Lactobacillus helveticus}
tkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyiae
tlqaladngitkmslrnvgvdnidmakakelgfqitnvpvysXytthavrnmvvkafdnn
lelvegkeaetpvkv

SCOP Domain Coordinates for d1j4ab2:

Click to download the PDB-style file with coordinates for d1j4ab2.
(The format of our PDB-style files is described here.)

Timeline for d1j4ab2: