Lineage for d1j49b2 (1j49 B:1-103,B:301-332)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391407Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 391408Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 391416Protein D-lactate dehydrogenase [52295] (1 species)
  7. 391417Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)
  8. 391423Domain d1j49b2: 1j49 B:1-103,B:301-332 [71501]
    Other proteins in same PDB: d1j49a1, d1j49b1
    complexed with nad, so4

Details for d1j49b2

PDB Entry: 1j49 (more details), 2.2 Å

PDB Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus

SCOP Domain Sequences for d1j49b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j49b2 c.23.12.1 (B:1-103,B:301-332) D-lactate dehydrogenase {Lactobacillus helveticus}
mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvysXytthavrnmvvkafdn
nlelvegkeaetpvkv

SCOP Domain Coordinates for d1j49b2:

Click to download the PDB-style file with coordinates for d1j49b2.
(The format of our PDB-style files is described here.)

Timeline for d1j49b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j49b1