SCOPe 2.07: Domain d1j49a2: 1j49 A:1-103,A:301-332

Lineage for d1j49a2 (1j49 A:1-103,A:301-332)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein D-lactate dehydrogenase [52295] (1 species)

7. Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)

8. Domain d1j49a2: 1j49 A:1-103,A:301-332 [71499]
   Other proteins in same PDB: d1j49a1, d1j49b1
   complexed with nad, so4

Details for d1j49a2

PDB Entry: 1j49, 2.2 Å

PDB Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus

PDB Compounds: (A:) d-lactate dehydrogenase

SCOPe Domain Sequences for d1j49a2:

Sequence; same for both SEQRES and ATOM records:

>d1j49a2 c.23.12.1 (A:1-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
mtkifayairedekpflkewedahkdveveytdklltpetvalakgadgvvvyqqldyia
etlqaladngitkmslrnvgvdnidmakakelgfqitnvpvysXytthavrnmvvkafdn
nlelvegkeaetpvkv

Timeline for d1j49a2:

• d1j49a2 first appeared in SCOP 1.61
  
• d1j49a2 appears in SCOPe 2.06
  
• d1j49a2 appears in the current release, SCOPe 2.08