Lineage for d1j49a1 (1j49 A:104-300)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452504Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 2452512Protein D-lactate dehydrogenase [51841] (1 species)
  7. 2452513Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries)
  8. 2452518Domain d1j49a1: 1j49 A:104-300 [71498]
    Other proteins in same PDB: d1j49a2, d1j49b2
    complexed with nad, so4

Details for d1j49a1

PDB Entry: 1j49 (more details), 2.2 Å

PDB Description: insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus
PDB Compounds: (A:) d-lactate dehydrogenase

SCOPe Domain Sequences for d1j49a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j49a1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
pnaiaehaaiqaarilrqdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmq
imegfgakvitydifrnpelekkgyyvdslddlykqadvislhvpdvpanvhmindesia
kmkqdvvivnvsrgplvdtdavirgldsgkifgyamdvyegevgifnedwegkefpdarl
adliarpnvlvtphtaf

SCOPe Domain Coordinates for d1j49a1:

Click to download the PDB-style file with coordinates for d1j49a1.
(The format of our PDB-style files is described here.)

Timeline for d1j49a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j49a2