![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
![]() | Protein D-lactate dehydrogenase [51841] (1 species) |
![]() | Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries) |
![]() | Domain d1j49a1: 1j49 A:104-300 [71498] Other proteins in same PDB: d1j49a2, d1j49b2 complexed with nad, so4 |
PDB Entry: 1j49 (more details), 2.2 Å
SCOPe Domain Sequences for d1j49a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j49a1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} pnaiaehaaiqaarilrqdkamdekvarhdlrwaptigrevrdqvvgvvgtghigqvfmq imegfgakvitydifrnpelekkgyyvdslddlykqadvislhvpdvpanvhmindesia kmkqdvvivnvsrgplvdtdavirgldsgkifgyamdvyegevgifnedwegkefpdarl adliarpnvlvtphtaf
Timeline for d1j49a1: