Lineage for d1iw7p_ (1iw7 P:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216884Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily)
    multihelical; consists of several all-alpha subdomains
  4. 216885Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) (S)
  5. 216886Family a.112.1.1: RNA polymerase sigma subunit [48330] (4 proteins)
  6. 216898Protein sigma70 subunit fragments [48331] (2 species)
  7. 216901Species Thermus thermophilus [TaxId:274] [74766] (1 PDB entry)
  8. 216903Domain d1iw7p_: 1iw7 P: [71485]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_
    complexed with mg, pb

Details for d1iw7p_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7p_:

Sequence, based on SEQRES records: (download)

>d1iw7p_ a.112.1.1 (P:) sigma70 subunit fragments {Thermus thermophilus}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
glidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d1iw7p_ a.112.1.1 (P:) sigma70 subunit fragments {Thermus thermophilus}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOP Domain Coordinates for d1iw7p_:

Click to download the PDB-style file with coordinates for d1iw7p_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7p_: