Lineage for d1iw7k1 (1iw7 K:1-49,K:173-229)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193436Fold d.74: DCoH-like [55247] (4 superfamilies)
  4. 193508Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
  5. 193509Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 193510Protein RNA polymerase alpha [55259] (3 species)
  7. 193519Species Thermus thermophilus [TaxId:274] [75478] (1 PDB entry)
  8. 193522Domain d1iw7k1: 1iw7 K:1-49,K:173-229 [71478]
    Other proteins in same PDB: d1iw7a2, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k2, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p_

Details for d1iw7k1

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7k1 d.74.3.1 (K:1-49,K:173-229) RNA polymerase alpha {Thermus thermophilus}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOP Domain Coordinates for d1iw7k1:

Click to download the PDB-style file with coordinates for d1iw7k1.
(The format of our PDB-style files is described here.)

Timeline for d1iw7k1: