SCOPe 2.08: Domain d1iw7b1: 1iw7 B:1-49,B:173-229

Lineage for d1iw7b1 (1iw7 B:1-49,B:173-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d1iw7b1: 1iw7 B:1-49,B:173-229 [71472]
   Other proteins in same PDB: d1iw7a2, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k2, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p1, d1iw7p2, d1iw7p3
   complexed with mg, pb

Details for d1iw7b1

PDB Entry: 1iw7, 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

PDB Compounds: (B:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1iw7b1:

Sequence; same for both SEQRES and ATOM records:

>d1iw7b1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d1iw7b1:

• d1iw7b1 first appeared in SCOP 1.61
  
• d1iw7b1 appears in SCOPe 2.07