SCOP 1.61: Domain d1iw7a1: 1iw7 A:1-49,A:173-229

Lineage for d1iw7a1 (1iw7 A:1-49,A:173-229)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (1 PDB entry)

8. Domain d1iw7a1: 1iw7 A:1-49,A:173-229 [71470]
   Other proteins in same PDB: d1iw7a2, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f_, d1iw7k2, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p_

Details for d1iw7a1

PDB Entry: 1iw7, 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7a1:

Sequence; same for both SEQRES and ATOM records:

>d1iw7a1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d1iw7a1:

• d1iw7a1 is new in SCOP 1.61
  
• d1iw7a1 appears in SCOP 1.63
  
• d1iw7a1 appears in the current release, SCOPe 2.08