Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (14 PDB entries) |
Domain d1ivxb3: 1ivx B:97-211 [71467] Other proteins in same PDB: d1ivxa1, d1ivxb1 |
PDB Entry: 1ivx (more details), 2.2 Å
SCOP Domain Sequences for d1ivxb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivxb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis} elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
Timeline for d1ivxb3: