SCOP 1.69: Domain d1ivxa3: 1ivx A:97-211

Lineage for d1ivxa3 (1ivx A:97-211)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (14 PDB entries)

8. Domain d1ivxa3: 1ivx A:97-211 [71464]
   Other proteins in same PDB: d1ivxa1, d1ivxb1

Details for d1ivxa3

PDB Entry: 1ivx, 2.2 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: holo form generated by biogenesis in crystal.

SCOP Domain Sequences for d1ivxa3:

Sequence; same for both SEQRES and ATOM records:

>d1ivxa3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d1ivxa3:

• d1ivxa3 first appeared in SCOP 1.61
  
• d1ivxa3 appears in SCOP 1.67
  
• d1ivxa3 appears in SCOP 1.71
  
• d1ivxa3 appears in the current release, SCOPe 2.08