Lineage for d1ivxa3 (1ivx A:97-211)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190052Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 190053Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 190054Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 190055Species Arthrobacter globiformis [TaxId:1665] [54421] (7 PDB entries)
  8. 190073Domain d1ivxa3: 1ivx A:97-211 [71464]
    Other proteins in same PDB: d1ivxa1, d1ivxb1

Details for d1ivxa3

PDB Entry: 1ivx (more details), 2.2 Å

PDB Description: Crystal structure of copper amine oxidase from Arthrobacter globiformis: Holo form generated by biogenesis in crystal.

SCOP Domain Sequences for d1ivxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivxa3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1ivxa3:

Click to download the PDB-style file with coordinates for d1ivxa3.
(The format of our PDB-style files is described here.)

Timeline for d1ivxa3: