SCOPe 2.06: Domain d1ivxa1: 1ivx A:212-628

Lineage for d1ivxa1 (1ivx A:212-628)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family)
   automatically mapped to Pfam PF01179

5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)

6. Protein Copper amine oxidase, domain 3 [50000] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [50003] (40 PDB entries)
   Uniprot P46881 9-628

8. Domain d1ivxa1: 1ivx A:212-628 [71462]
   Other proteins in same PDB: d1ivxa2, d1ivxa3, d1ivxb2, d1ivxb3
   complexed with cu

Details for d1ivxa1

PDB Entry: 1ivx, 2.2 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: holo form generated by biogenesis in crystal.

PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d1ivxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ivxa1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

Timeline for d1ivxa1:

• d1ivxa1 first appeared in SCOP 1.61
  
• d1ivxa1 appears in SCOPe 2.05
  
• d1ivxa1 appears in SCOPe 2.07
  
• d1ivxa1 appears in the current release, SCOPe 2.08