Lineage for d1ivxa1 (1ivx A:212-628)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165116Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 165117Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 165118Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 165119Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 165120Species Arthrobacter globiformis [TaxId:1665] [50003] (7 PDB entries)
  8. 165129Domain d1ivxa1: 1ivx A:212-628 [71462]
    Other proteins in same PDB: d1ivxa2, d1ivxa3, d1ivxb2, d1ivxb3

Details for d1ivxa1

PDB Entry: 1ivx (more details), 2.2 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: holo form generated by biogenesis in crystal.

SCOP Domain Sequences for d1ivxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivxa1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 (catalytic) {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1ivxa1:

Click to download the PDB-style file with coordinates for d1ivxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ivxa1: