SCOP 1.71: Domain d1ivwb2: 1ivw B:9-96

Lineage for d1ivwb2 (1ivw B:9-96)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries)

8. Domain d1ivwb2: 1ivw B:9-96 [71460]
   Other proteins in same PDB: d1ivwa1, d1ivwb1

Details for d1ivwb2

PDB Entry: 1ivw, 1.8 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: late intermediate in topaquinone biogenesis

SCOP Domain Sequences for d1ivwb2:

Sequence; same for both SEQRES and ATOM records:

>d1ivwb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d1ivwb2:

• d1ivwb2 first appeared in SCOP 1.61
  
• d1ivwb2 appears in SCOP 1.69
  
• d1ivwb2 appears in SCOP 1.73
  
• d1ivwb2 appears in the current release, SCOPe 2.08