Lineage for d1ivvb2 (1ivv B:9-96)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500682Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 500683Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 500684Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 500685Species Arthrobacter globiformis [TaxId:1665] [54421] (14 PDB entries)
  8. 500716Domain d1ivvb2: 1ivv B:9-96 [71454]
    Other proteins in same PDB: d1ivva1, d1ivvb1

Details for d1ivvb2

PDB Entry: 1ivv (more details), 2.1 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: early intermediate in topaquinone biogenesis

SCOP Domain Sequences for d1ivvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivvb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d1ivvb2:

Click to download the PDB-style file with coordinates for d1ivvb2.
(The format of our PDB-style files is described here.)

Timeline for d1ivvb2: