Lineage for d1ivva1 (1ivv A:212-628)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664385Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 664386Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 664387Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 664388Species Arthrobacter globiformis [TaxId:1665] [50003] (34 PDB entries)
  8. 664440Domain d1ivva1: 1ivv A:212-628 [71450]
    Other proteins in same PDB: d1ivva2, d1ivva3, d1ivvb2, d1ivvb3

Details for d1ivva1

PDB Entry: 1ivv (more details), 2.1 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: early intermediate in topaquinone biogenesis
PDB Compounds: (A:) amine oxidase

SCOP Domain Sequences for d1ivva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivva1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignfdygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1ivva1:

Click to download the PDB-style file with coordinates for d1ivva1.
(The format of our PDB-style files is described here.)

Timeline for d1ivva1: