Lineage for d1itub_ (1itu B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572401Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
  6. 572402Protein Renal dipeptidase [75080] (1 species)
  7. 572403Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)
  8. 572405Domain d1itub_: 1itu B: [71424]
    complexed with cil, nag, zn

Details for d1itub_

PDB Entry: 1itu (more details), 2 Å

PDB Description: human renal dipeptidase complexed with cilastatin

SCOP Domain Sequences for d1itub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itub_ c.1.9.7 (B:) Renal dipeptidase {Human (Homo sapiens)}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

SCOP Domain Coordinates for d1itub_:

Click to download the PDB-style file with coordinates for d1itub_.
(The format of our PDB-style files is described here.)

Timeline for d1itub_: