SCOPe 2.05: Domain d1itua_: 1itu A:

Lineage for d1itua_ (1itu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
   automatically mapped to Pfam PF01244

6. Protein Renal dipeptidase [75080] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)

8. Domain d1itua_: 1itu A: [71423]
   complexed with cil, nag, zn

Details for d1itua_

PDB Entry: 1itu, 2 Å

PDB Description: human renal dipeptidase complexed with cilastatin

PDB Compounds: (A:) renal dipeptidase

SCOPe Domain Sequences for d1itua_:

Sequence; same for both SEQRES and ATOM records:

>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

Timeline for d1itua_:

• d1itua_ first appeared in SCOP 1.61
  
• d1itua_ appears in SCOPe 2.04
  
• d1itua_ appears in SCOPe 2.06
  
• d1itua_ appears in the current release, SCOPe 2.08