Lineage for d1itua_ (1itu A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236978Superfamily c.1.9: Metallo-dependent hydrolases [51556] (12 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 237096Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
  6. 237097Protein Renal dipeptidase [75080] (1 species)
  7. 237098Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)
  8. 237099Domain d1itua_: 1itu A: [71423]

Details for d1itua_

PDB Entry: 1itu (more details), 2 Å

PDB Description: human renal dipeptidase complexed with cilastatin

SCOP Domain Sequences for d1itua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens)}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

SCOP Domain Coordinates for d1itua_:

Click to download the PDB-style file with coordinates for d1itua_.
(The format of our PDB-style files is described here.)

Timeline for d1itua_: