Lineage for d1itua_ (1itu A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (12 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.7: Renal dipeptidase [75079] (1 protein) Protein Renal dipeptidase [75080] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries) 
Domain d1itua_: 1itu A: [71423]
Details for d1itua_
PDB Entry: 1itu (more details), 2 Å
PDB Description: human renal dipeptidase complexed with cilastatin
SCOP Domain Sequences for d1itua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens)}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss
SCOP Domain Coordinates for d1itua_:
Click to download the PDB-style file with coordinates for d1itua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1itua_:
- d1itua_ first appeared in SCOP 1.61
- d1itua_ appears in SCOP 1.65
- d1itua_ appears in the current release, SCOPe 2.08
View in 3D
