Lineage for d1itqb_ (1itq B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096423Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
    automatically mapped to Pfam PF01244
  6. 2096424Protein Renal dipeptidase [75080] (1 species)
  7. 2096425Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)
  8. 2096429Domain d1itqb_: 1itq B: [71422]
    complexed with nag, zn

Details for d1itqb_

PDB Entry: 1itq (more details), 2.3 Å

PDB Description: human renal dipeptidase
PDB Compounds: (B:) renal dipeptidase

SCOPe Domain Sequences for d1itqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itqb_ c.1.9.7 (B:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

SCOPe Domain Coordinates for d1itqb_:

Click to download the PDB-style file with coordinates for d1itqb_.
(The format of our PDB-style files is described here.)

Timeline for d1itqb_: