![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.7: Renal dipeptidase [75079] (1 protein) |
![]() | Protein Renal dipeptidase [75080] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries) |
![]() | Domain d1itqb_: 1itq B: [71422] complexed with nag, zn |
PDB Entry: 1itq (more details), 2.3 Å
SCOP Domain Sequences for d1itqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itqb_ c.1.9.7 (B:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs crthygyss
Timeline for d1itqb_: