Lineage for d1itqb_ (1itq B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475291Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
  6. 475292Protein Renal dipeptidase [75080] (1 species)
  7. 475293Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)
  8. 475297Domain d1itqb_: 1itq B: [71422]

Details for d1itqb_

PDB Entry: 1itq (more details), 2.3 Å

PDB Description: human renal dipeptidase

SCOP Domain Sequences for d1itqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itqb_ c.1.9.7 (B:) Renal dipeptidase {Human (Homo sapiens)}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

SCOP Domain Coordinates for d1itqb_:

Click to download the PDB-style file with coordinates for d1itqb_.
(The format of our PDB-style files is described here.)

Timeline for d1itqb_: