Lineage for d1itqa_ (1itq A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173878Superfamily c.1.9: Metallo-dependent hydrolases [51556] (8 families) (S)
  5. 173994Family c.1.9.7: Renal dipeptidase [75079] (1 protein)
  6. 173995Protein Renal dipeptidase [75080] (1 species)
  7. 173996Species Human (Homo sapiens) [TaxId:9606] [75081] (2 PDB entries)
  8. 173999Domain d1itqa_: 1itq A: [71421]

Details for d1itqa_

PDB Entry: 1itq (more details), 2.3 Å

PDB Description: human renal dipeptidase

SCOP Domain Sequences for d1itqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itqa_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens)}
dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
crthygyss

SCOP Domain Coordinates for d1itqa_:

Click to download the PDB-style file with coordinates for d1itqa_.
(The format of our PDB-style files is described here.)

Timeline for d1itqa_: