Lineage for d1itkb2 (1itk B:424-731)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005634Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 2005635Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 2005720Species Haloarcula marismortui [TaxId:2238] [74755] (1 PDB entry)
  8. 2005724Domain d1itkb2: 1itk B:424-731 [71420]
    complexed with cl, hem, so4, unx

Details for d1itkb2

PDB Entry: 1itk (more details), 2 Å

PDB Description: Crystal structure of catalase-peroxidase from Haloarcula marismortui
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d1itkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itkb2 a.93.1.3 (B:424-731) Catalase-peroxidase KatG {Haloarcula marismortui [TaxId: 2238]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

SCOPe Domain Coordinates for d1itkb2:

Click to download the PDB-style file with coordinates for d1itkb2.
(The format of our PDB-style files is described here.)

Timeline for d1itkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1itkb1