Lineage for d1it8a1 (1it8 A:6-360)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307773Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 307774Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 307775Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 307776Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75097] (4 PDB entries)
  8. 307781Domain d1it8a1: 1it8 A:6-360 [71413]
    Other proteins in same PDB: d1it8a3, d1it8a4, d1it8b3, d1it8b4

Details for d1it8a1

PDB Entry: 1it8 (more details), 2.5 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii complexed with archaeosine precursor, preq0

SCOP Domain Sequences for d1it8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii}
kmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsy
iiykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdi
gtfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrls
smnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgv
dlfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrlla
lhnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOP Domain Coordinates for d1it8a1:

Click to download the PDB-style file with coordinates for d1it8a1.
(The format of our PDB-style files is described here.)

Timeline for d1it8a1: