![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
![]() | Family a.11.2.1: Second domain of FERM [47032] (8 proteins) |
![]() | Protein Merlin [68980] (2 species) the neurofibromatosis 2 tumor suppressor protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74702] (1 PDB entry) |
![]() | Domain d1isna1: 1isn A:104-214 [71400] Other proteins in same PDB: d1isna2, d1isna3 |
PDB Entry: 1isn (more details), 2.9 Å
SCOP Domain Sequences for d1isna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isna1 a.11.2.1 (A:104-214) Merlin {Mouse (Mus musculus) [TaxId: 10090]} naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d1isna1: