Lineage for d1irxb2 (1irx B:3-319)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178486Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (10 proteins)
  6. 178494Protein Class I lysyl-tRNA synthetase [75159] (1 species)
  7. 178495Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75160] (1 PDB entry)
  8. 178497Domain d1irxb2: 1irx B:3-319 [71381]
    Other proteins in same PDB: d1irxa1, d1irxb1

Details for d1irxb2

PDB Entry: 1irx (more details), 2.6 Å

PDB Description: Crystal structure of class I lysyl-tRNA synthetase

SCOP Domain Sequences for d1irxb2:

Sequence, based on SEQRES records: (download)

>d1irxb2 c.26.1.1 (B:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii}
hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
agssydtgkeiikevygkeaplslmyefvgikgqkgkmsgskgnvillsdlyevlepglv
rfiyarhrpnkeikidl

Sequence, based on observed residues (ATOM records): (download)

>d1irxb2 c.26.1.1 (B:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii}
hwadyiadkiirergekekyvvesgitpsgyvhvgnfrelftayivghalrdkgyevrhi
hmwddydrfrkvprnvpqewkdylgmpisevpdpwgchesyaehfmrkfeeeveklgiev
dllyaselykrgeyseeirlafekrdkimeilnkyreiakqpplpenwwpamvycpehrr
eaeiiewdggwkvkykcpeghegwvdirsgnvklrwrvdwpmrwshfgvdfepagkdhlv
agssydtgkeiikevygkeaplslmyefvgikgqnvillsdlyevlepglvrfiyarhrp
nkeikidl

SCOP Domain Coordinates for d1irxb2:

Click to download the PDB-style file with coordinates for d1irxb2.
(The format of our PDB-style files is described here.)

Timeline for d1irxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1irxb1