Lineage for d1irxb1 (1irx B:320-523)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155141Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
  4. 155142Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (2 families) (S)
  5. 155149Family a.97.1.2: C-terminal domain of class I lysyl-tRNA synthetase [74759] (1 protein)
  6. 155150Protein C-terminal domain of class I lysyl-tRNA synthetase [74760] (1 species)
  7. 155151Species Archaeon Pyrococcus horikoshii [TaxId:53953] [74761] (1 PDB entry)
  8. 155153Domain d1irxb1: 1irx B:320-523 [71380]
    Other proteins in same PDB: d1irxa2, d1irxb2

Details for d1irxb1

PDB Entry: 1irx (more details), 2.6 Å

PDB Description: Crystal structure of class I lysyl-tRNA synthetase

SCOP Domain Sequences for d1irxb1:

Sequence, based on SEQRES records: (download)

>d1irxb1 a.97.1.2 (B:320-523) C-terminal domain of class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii}
glgilnlydefekveriyfgveggkgddeelrrtyelsmpkkperlvaqapfrflavlvq
lphlteediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsilekppe
vevsedvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfigker
gprlasflasldrsfvikrlrleg

Sequence, based on observed residues (ATOM records): (download)

>d1irxb1 a.97.1.2 (B:320-523) C-terminal domain of class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii}
glgilnlydefekveriyfgvegdeelrrtyelsmpkkperlvaqapfrflavlvqlphl
teediinvlikqghiprdlskedvervklrinlarnwvkkyapedvkfsilekppevevs
edvreamnevaewlenheefsveefnnilfevakrrgissrewfstlyrlfigkergprl
asflasldrsfvikrlrleg

SCOP Domain Coordinates for d1irxb1:

Click to download the PDB-style file with coordinates for d1irxb1.
(The format of our PDB-style files is described here.)

Timeline for d1irxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1irxb2