Lineage for d1iruu_ (1iru U:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612721Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 612722Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 612861Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 612946Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 613034Species Cow (Bos taurus) [TaxId:9913] [75568] (1 PDB entry)
  8. 613048Domain d1iruu_: 1iru U: [71372]
    Other proteins in same PDB: d1iru1_, d1iru2_, d1iruh_, d1irui_, d1iruj_, d1iruk_, d1irul_, d1irum_, d1irun_, d1iruv_, d1iruw_, d1irux_, d1iruy_, d1iruz_
    different sequences
    complexed with mg

Details for d1iruu_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution

SCOP Domain Sequences for d1iruu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iruu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus)}
ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee
gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh
aytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklq
mkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyak
eslke

SCOP Domain Coordinates for d1iruu_:

Click to download the PDB-style file with coordinates for d1iruu_.
(The format of our PDB-style files is described here.)

Timeline for d1iruu_: