Lineage for d1iruk_ (1iru K:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197956Protein Proteasome beta subunit (catalytic) [56252] (3 species)
  7. 198029Species Cow (Bos taurus) [TaxId:9913] [75567] (1 PDB entry)
  8. 198035Domain d1iruk_: 1iru K: [71362]
    Other proteins in same PDB: d1irua_, d1irub_, d1iruc_, d1irud_, d1irue_, d1iruf_, d1irug_, d1iruo_, d1irup_, d1iruq_, d1irur_, d1irus_, d1irut_, d1iruu_

Details for d1iruk_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution

SCOP Domain Sequences for d1iruk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus)}
meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
riidkngihdldnisfpkq

SCOP Domain Coordinates for d1iruk_:

Click to download the PDB-style file with coordinates for d1iruk_.
(The format of our PDB-style files is described here.)

Timeline for d1iruk_: