SCOP 1.73: Domain d1irmc_: 1irm C:

Lineage for d1irmc_ (1irm C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (13 PDB entries)

8. Domain d1irmc_: 1irm C: [71349]

Details for d1irmc_

PDB Entry: 1irm, 2.55 Å

PDB Description: Crystal structure of apo heme oxygenase-1

PDB Compounds: (C:) apo heme oxygenase-1

SCOP Domain Sequences for d1irmc_:

Sequence; same for both SEQRES and ATOM records:

>d1irmc_ a.132.1.1 (C:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus) [TaxId: 10116]}
nsefmrnfqkgqvsregfklvmaslyhiytaleeeiernkqnpvyaplyfpeelhrraal
eqdmafwygphwqeaipytpatqhyvkrlhevggthpellvahaytrylgdlsggqvlkk
iaqkamalpssgeglafftfpsidnptkfkqlyrarmntlemtpevkhrvteeaktafll
nielfeelqallteeh

Timeline for d1irmc_:

• d1irmc_ first appeared in SCOP 1.61
  
• d1irmc_ appears in SCOP 1.71
  
• d1irmc_ appears in SCOP 1.75
  
• d1irmc_ appears in the current release, SCOPe 2.08