Lineage for d1ir2b1 (1ir2 B:150-475)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100574Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2100598Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (4 PDB entries)
  8. 2100600Domain d1ir2b1: 1ir2 B:150-475 [71304]
    Other proteins in same PDB: d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a2, d1ir2b2, d1ir2c2, d1ir2d2, d1ir2e2, d1ir2f2, d1ir2g2, d1ir2h2, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2s2, d1ir2t2, d1ir2u2, d1ir2v2, d1ir2w2, d1ir2x2, d1ir2y2, d1ir2z2
    complexed with cap, gol, mg

Details for d1ir2b1

PDB Entry: 1ir2 (more details), 1.84 Å

PDB Description: Crystal Structure of Activated Ribulose-1,5-bisphosphate Carboxylase/oxygenase (Rubisco) from Green alga, Chlamydomonas reinhardtii Complexed with 2-Carboxyarabinitol-1,5-bisphosphate (2-CABP)
PDB Compounds: (B:) Large subunit of Rubisco

SCOPe Domain Sequences for d1ir2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir2b1 c.1.14.1 (B:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1ir2b1:

Click to download the PDB-style file with coordinates for d1ir2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ir2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ir2b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ir21_, d1ir22_, d1ir23_, d1ir24_, d1ir25_, d1ir26_, d1ir27_, d1ir28_, d1ir2a1, d1ir2a2, d1ir2c1, d1ir2c2, d1ir2d1, d1ir2d2, d1ir2e1, d1ir2e2, d1ir2f1, d1ir2f2, d1ir2g1, d1ir2g2, d1ir2h1, d1ir2h2, d1ir2i_, d1ir2j_, d1ir2k_, d1ir2l_, d1ir2m_, d1ir2n_, d1ir2o_, d1ir2p_, d1ir2s1, d1ir2s2, d1ir2t1, d1ir2t2, d1ir2u1, d1ir2u2, d1ir2v1, d1ir2v2, d1ir2w1, d1ir2w2, d1ir2x1, d1ir2x2, d1ir2y1, d1ir2y2, d1ir2z1, d1ir2z2