Lineage for d1ir1u_ (1ir1 U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957754Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2957761Domain d1ir1u_: 1ir1 U: [71292]
    Other proteins in same PDB: d1ir1a1, d1ir1a2, d1ir1b1, d1ir1b2, d1ir1c1, d1ir1c2, d1ir1d1, d1ir1d2
    complexed with cap, mg

Details for d1ir1u_

PDB Entry: 1ir1 (more details), 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate
PDB Compounds: (U:) Small subunit of Rubisco

SCOPe Domain Sequences for d1ir1u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir1u_ d.73.1.1 (U:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mkvwptqnmkryetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrqvqcvsfiaykp
agy

SCOPe Domain Coordinates for d1ir1u_:

Click to download the PDB-style file with coordinates for d1ir1u_.
(The format of our PDB-style files is described here.)

Timeline for d1ir1u_: