![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (8 PDB entries) |
![]() | Domain d1ir1d2: 1ir1 D:12-147 [71289] Other proteins in same PDB: d1ir1a1, d1ir1b1, d1ir1c1, d1ir1d1, d1ir1s_, d1ir1t_, d1ir1u_, d1ir1v_ complexed with cap, kcx, mg, mme |
PDB Entry: 1ir1 (more details), 1.8 Å
SCOP Domain Sequences for d1ir1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ir1d2 d.58.9.1 (D:12-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)} efkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwttvwt dgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfkalr alrledlripvayvkt
Timeline for d1ir1d2: