Lineage for d1ir1a1 (1ir1 A:148-475)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100574Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2100672Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)
  8. 2100681Domain d1ir1a1: 1ir1 A:148-475 [71282]
    Other proteins in same PDB: d1ir1a2, d1ir1b2, d1ir1c2, d1ir1d2, d1ir1s_, d1ir1t_, d1ir1u_, d1ir1v_
    complexed with cap, mg

Details for d1ir1a1

PDB Entry: 1ir1 (more details), 1.8 Å

PDB Description: Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate
PDB Compounds: (A:) Large subunit of Rubisco

SCOPe Domain Sequences for d1ir1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir1a1 c.1.14.1 (A:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d1ir1a1:

Click to download the PDB-style file with coordinates for d1ir1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ir1a1: