SCOP 1.69: Domain d1ipkc1: 1ipk C:3-180

Lineage for d1ipkc1 (1ipk C:3-180)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (13 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species beta-conglycinin beta subunit [109608] (3 PDB entries)

8. Domain d1ipkc1: 1ipk C:3-180 [71268]

Details for d1ipkc1

PDB Entry: 1ipk, 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers

SCOP Domain Sequences for d1ipkc1:

Sequence; same for both SEQRES and ATOM records:

>d1ipkc1 b.82.1.2 (C:3-180) Seed storage 7S protein {beta-conglycinin beta subunit}
vredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntil
lphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlki
iklaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq

Timeline for d1ipkc1:

• d1ipkc1 first appeared in SCOP 1.61
  
• d1ipkc1 appears in SCOP 1.67
  
• d1ipkc1 appears in SCOP 1.71
  
• d1ipkc1 appears in the current release, SCOPe 2.08