Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries) Uniprot P25974 |
Domain d1ipkb2: 1ipk B:183-392 [71267] |
PDB Entry: 1ipk (more details), 2.7 Å
SCOP Domain Sequences for d1ipkb2:
Sequence, based on SEQRES records: (download)
>d1ipkb2 b.82.1.2 (B:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie rqvqelafpgsaqdverllkkqresyfvda
>d1ipkb2 b.82.1.2 (B:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikelevqryraelse ddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgs aqdverllkkqresyfvda
Timeline for d1ipkb2:
View in 3D Domains from other chains: (mouse over for more information) d1ipka1, d1ipka2, d1ipkc1, d1ipkc2 |