Lineage for d1ipkb2 (1ipk B:183-392)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470598Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 470617Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 470618Species beta-conglycinin beta subunit [109608] (3 PDB entries)
  8. 470640Domain d1ipkb2: 1ipk B:183-392 [71267]

Details for d1ipkb2

PDB Entry: 1ipk (more details), 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers

SCOP Domain Sequences for d1ipkb2:

Sequence, based on SEQRES records: (download)

>d1ipkb2 b.82.1.2 (B:183-392) Seed storage 7S protein {beta-conglycinin beta subunit}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl
evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie
rqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records): (download)

>d1ipkb2 b.82.1.2 (B:183-392) Seed storage 7S protein {beta-conglycinin beta subunit}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikelevqryraelse
ddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgs
aqdverllkkqresyfvda

SCOP Domain Coordinates for d1ipkb2:

Click to download the PDB-style file with coordinates for d1ipkb2.
(The format of our PDB-style files is described here.)

Timeline for d1ipkb2: