Lineage for d1ipka2 (1ipk A:183-392)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809794Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 809817Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 809859Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries)
    Uniprot P25974
  8. 809879Domain d1ipka2: 1ipk A:183-392 [71265]

Details for d1ipka2

PDB Entry: 1ipk (more details), 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers
PDB Compounds: (A:) beta-conglycinin, beta chain

SCOP Domain Sequences for d1ipka2:

Sequence, based on SEQRES records: (download)

>d1ipka2 b.82.1.2 (A:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl
evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie
rqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records): (download)

>d1ipka2 b.82.1.2 (A:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqplevqryrael
seddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafp
gsaqdverllkkqresyfvda

SCOP Domain Coordinates for d1ipka2:

Click to download the PDB-style file with coordinates for d1ipka2.
(The format of our PDB-style files is described here.)

Timeline for d1ipka2: