SCOP 1.67: Domain d1ipka2: 1ipk A:183-392

Lineage for d1ipka2 (1ipk A:183-392)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (12 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (5 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), beta-conglycinin [75032] (2 PDB entries)

8. Domain d1ipka2: 1ipk A:183-392 [71265]

Details for d1ipka2

PDB Entry: 1ipk, 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers

SCOP Domain Sequences for d1ipka2:

Sequence, based on SEQRES records:

>d1ipka2 b.82.1.2 (A:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl
evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie
rqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records):

>d1ipka2 b.82.1.2 (A:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqplevqryrael
seddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafp
gsaqdverllkkqresyfvda

Timeline for d1ipka2:

• d1ipka2 first appeared in SCOP 1.61
  
• d1ipka2 appears in SCOP 1.65
  
• d1ipka2 appears in SCOP 1.69
  
• d1ipka2 appears in the current release, SCOPe 2.08