SCOP 1.69: Domain d1ipjb1: 1ipj B:9-175

Lineage for d1ipjb1 (1ipj B:9-175)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (13 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species beta-conglycinin beta subunit [109608] (3 PDB entries)

8. Domain d1ipjb1: 1ipj B:9-175 [71260]

Details for d1ipjb1

PDB Entry: 1ipj, 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine

SCOP Domain Sequences for d1ipjb1:

Sequence; same for both SEQRES and ATOM records:

>d1ipjb1 b.82.1.2 (B:9-175) Seed storage 7S protein {beta-conglycinin beta subunit}
nnpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvll

Timeline for d1ipjb1:

• d1ipjb1 first appeared in SCOP 1.61
  
• d1ipjb1 appears in SCOP 1.67
  
• d1ipjb1 appears in SCOP 1.71
  
• d1ipjb1 appears in the current release, SCOPe 2.08