Lineage for d1ipja1 (1ipj A:9-176)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814575Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2814631Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries)
    Uniprot P25974
  8. 2814644Domain d1ipja1: 1ipj A:9-176 [71258]
    complexed with nag

Details for d1ipja1

PDB Entry: 1ipj (more details), 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine
PDB Compounds: (A:) beta-conglycinin, beta chain

SCOPe Domain Sequences for d1ipja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipja1 b.82.1.2 (A:9-176) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
nnpfylrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphha
dadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklai
pvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvllg

SCOPe Domain Coordinates for d1ipja1:

Click to download the PDB-style file with coordinates for d1ipja1.
(The format of our PDB-style files is described here.)

Timeline for d1ipja1: