Lineage for d1ipaa2 (1ipa A:1-105)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566851Family d.79.3.3: RNA 2'-O ribose methyltransferase substrate binding domain [75480] (2 proteins)
  6. 2566860Protein RrmA (RrmH), N-terminal domain [75481] (1 species)
    23S rRNA methyltransferase; proposed gene names are as appear in the original publication (and the PDB entry)
  7. 2566861Species Thermus thermophilus [TaxId:274] [75482] (1 PDB entry)
  8. 2566862Domain d1ipaa2: 1ipa A:1-105 [71255]
    Other proteins in same PDB: d1ipaa1

Details for d1ipaa2

PDB Entry: 1ipa (more details), 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase
PDB Compounds: (A:) RNA 2'-o-ribose methyltransferase

SCOPe Domain Sequences for d1ipaa2:

Sequence, based on SEQRES records: (download)

>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaalgrvgrlallevseavlkklsvrdnpaglialarmper

Sequence, based on observed residues (ATOM records): (download)

>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaallallevseavlkklsvrdnpaglialarmper

SCOPe Domain Coordinates for d1ipaa2:

Click to download the PDB-style file with coordinates for d1ipaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ipaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ipaa1