SCOPe 2.08: Domain d1ipaa2: 1ipa A:1-105

Lineage for d1ipaa2 (1ipa A:1-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.3: RNA 2'-O ribose methyltransferase substrate binding domain [75480] (2 proteins)

6. Protein RrmA (RrmH), N-terminal domain [75481] (1 species)
   23S rRNA methyltransferase; proposed gene names are as appear in the original publication (and the PDB entry)

7. Species Thermus thermophilus [TaxId:274] [75482] (1 PDB entry)

8. Domain d1ipaa2: 1ipa A:1-105 [71255]
   Other proteins in same PDB: d1ipaa1

Details for d1ipaa2

PDB Entry: 1ipa, 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase

PDB Compounds: (A:) RNA 2'-o-ribose methyltransferase

SCOPe Domain Sequences for d1ipaa2:

Sequence, based on SEQRES records:

>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaalgrvgrlallevseavlkklsvrdnpaglialarmper

Sequence, based on observed residues (ATOM records):

>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaallallevseavlkklsvrdnpaglialarmper

Timeline for d1ipaa2:

• d1ipaa2 first appeared in SCOP 1.61
  
• d1ipaa2 appears in SCOPe 2.07