SCOPe 2.05: Domain d1ipaa1: 1ipa A:106-263

Lineage for d1ipaa1 (1ipa A:106-263)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546

6. Protein RrmA (RrmH), C-terminal domain [75219] (1 species)
   23S rRNA methyltransferase; proposed gene names are as appear in the original publication (and the PDB entry)

7. Species Thermus thermophilus [TaxId:274] [75220] (1 PDB entry)

8. Domain d1ipaa1: 1ipa A:106-263 [71254]
   Other proteins in same PDB: d1ipaa2

Details for d1ipaa1

PDB Entry: 1ipa, 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase

PDB Compounds: (A:) RNA 2'-o-ribose methyltransferase

SCOPe Domain Sequences for d1ipaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ipaa1 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {Thermus thermophilus [TaxId: 274]}
tleeyrpspdalilvavglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgv
vfslrtlaasesevldwikqhnlplvattphaealyweanlrppvaiavgpeheglraaw
leaaqtqvripmqgqadslnvsvsaalllyealrqrll

Timeline for d1ipaa1:

• d1ipaa1 first appeared in SCOP 1.61
  
• d1ipaa1 appears in SCOPe 2.04
  
• d1ipaa1 appears in SCOPe 2.06
  
• d1ipaa1 appears in the current release, SCOPe 2.08