SCOP 1.61: Domain d1ipaa1: 1ipa A:106-263

Lineage for d1ipaa1 (1ipa A:106-263)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)

4. Superfamily c.116.1: alpha/beta knot [75217] (2 families)

5. Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (1 protein)

6. Protein RrmH, C-terminal domain [75219] (1 species)

7. Species Thermus thermophilus [TaxId:274] [75220] (1 PDB entry)

8. Domain d1ipaa1: 1ipa A:106-263 [71254]
   Other proteins in same PDB: d1ipaa2

Details for d1ipaa1

PDB Entry: 1ipa, 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase

SCOP Domain Sequences for d1ipaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ipaa1 c.116.1.1 (A:106-263) RrmH, C-terminal domain {Thermus thermophilus}
tleeyrpspdalilvavglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgv
vfslrtlaasesevldwikqhnlplvattphaealyweanlrppvaiavgpeheglraaw
leaaqtqvripmqgqadslnvsvsaalllyealrqrll

Timeline for d1ipaa1:

• d1ipaa1 is new in SCOP 1.61
  
• d1ipaa1 appears in SCOP 1.63
  
• d1ipaa1 appears in the current release, SCOPe 2.08