Lineage for d1ipaa1 (1ipa A:106-263)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 187002Fold c.116: alpha/beta knot [75216] (1 superfamily)
  4. 187003Superfamily c.116.1: alpha/beta knot [75217] (2 families) (S)
  5. 187004Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (1 protein)
  6. 187005Protein RrmH, C-terminal domain [75219] (1 species)
  7. 187006Species Thermus thermophilus [TaxId:274] [75220] (1 PDB entry)
  8. 187007Domain d1ipaa1: 1ipa A:106-263 [71254]
    Other proteins in same PDB: d1ipaa2

Details for d1ipaa1

PDB Entry: 1ipa (more details), 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase

SCOP Domain Sequences for d1ipaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipaa1 c.116.1.1 (A:106-263) RrmH, C-terminal domain {Thermus thermophilus}
tleeyrpspdalilvavglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgv
vfslrtlaasesevldwikqhnlplvattphaealyweanlrppvaiavgpeheglraaw
leaaqtqvripmqgqadslnvsvsaalllyealrqrll

SCOP Domain Coordinates for d1ipaa1:

Click to download the PDB-style file with coordinates for d1ipaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ipaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ipaa2